Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.25
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Bipolar Disorder 266 3.684 1.8

Synonym

Accession Q8NAA6
Symbols

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (3)

PMID Text
23089632 This family-based GWAS identified SNPs in C15orf53 that are strongly associated with DSM-IV alcohol-dependence symptoms.
20351715 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19488044 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MELQGAQEDLGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQGHQQELRDWNLG      1 - 70
EDASLLFSKSPFGAGKLIQAPAHVFRQCWVQGNAWISCITKFDSKRSPEVASSPSYLTVPRRSPLPVFLR     71 - 140
PSDRCVCGGCYLGKSTRRRACQSLLSDPLGVTFPTQTRP                                   141 - 179
//

Text Mined References (8)

PMID Year Title
23089632 2013 A genome-wide association study of alcohol-dependence symptom counts in extended pedigrees identifies C15orf53.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
20351715 2011 Meta-analysis of genome-wide association data of bipolar disorder and major depressive disorder.
19488044 2009 Genome-wide association study of bipolar disorder in European American and African American individuals.
18711365 2008 Collaborative genome-wide association analysis supports a role for ANK3 and CACNA1C in bipolar disorder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.