Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.25
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Bipolar Disorder 266 3.684 1.8

Synonym

Accession Q8NAA6
Symbols

Gene

 Compartment GO Term (1)

Gene RIF (3)

PMID Text
23089632 This family-based GWAS identified SNPs in C15orf53 that are strongly associated with DSM-IV alcohol-dependence symptoms.
20351715 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19488044 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MELQGAQEDLGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQGHQQELRDWNLG      1 - 70
EDASLLFSKSPFGAGKLIQAPAHVFRQCWVQGNAWISCITKFDSKRSPEVASSPSYLTVPRRSPLPVFLR     71 - 140
PSDRCVCGGCYLGKSTRRRACQSLLSDPLGVTFPTQTRP                                   141 - 179
//

Text Mined References (8)

PMID Year Title
23089632 2013 A genome-wide association study of alcohol-dependence symptom counts in extended pedigrees identifies C15orf53.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
20351715 2011 Meta-analysis of genome-wide association data of bipolar disorder and major depressive disorder.
19488044 2009 Genome-wide association study of bipolar disorder in European American and African American individuals.
18711365 2008 Collaborative genome-wide association analysis supports a role for ANK3 and CACNA1C in bipolar disorder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.