Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.25
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (3)

AA Sequence

MELQGAQEDLGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQGHQQELRDWNLG      1 - 70
EDASLLFSKSPFGAGKLIQAPAHVFRQCWVQGNAWISCITKFDSKRSPEVASSPSYLTVPRRSPLPVFLR     71 - 140
PSDRCVCGGCYLGKSTRRRACQSLLSDPLGVTFPTQTRP                                   141 - 179
//

Text Mined References (8)

PMID Year Title