Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.100 0.031
osteosarcoma -1.662 0.003
medulloblastoma, large-cell -1.400 0.008
group 4 medulloblastoma -1.600 0.000
ulcerative colitis -1.500 0.000

Synonym

Accession Q8NAA5
Symbols FAM211A
C17orf76

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKAGRAGAGMPPYHRRVGMVQELLRMVRQGRR      1 - 70
EEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKPEGDALGAMEKLCRQL     71 - 140
TYHLSPHSQWRRHRGLVKRKPQACLKAVLAGSPPDNTVDLSGIPLTSRDLERVTSYLQRCGEQVDSVELG    141 - 210
FTGLTDDMVLQLLPALSTLPRLTTLALNGNRLTRAVLRDLTDILKDPSKFPNVTWIDLGNNVDIFSLPQP    211 - 280
FLLSLRKRSPKQGHLPTILELGEGPGSGEEVREGTVGQEDPGGGPVAPAEDHHEGKETVAAAQT          281 - 344
//

Text Mined References (5)

PMID Year Title
21789175 2011 Identification and analysis of intermediate size noncoding RNAs in the human fetal brain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.