Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.100 3.1e-02
group 4 medulloblastoma -1.600 1.7e-04
medulloblastoma, large-cell -1.400 7.9e-03
osteosarcoma -1.662 3.1e-03
ulcerative colitis -1.500 2.8e-04

Gene RIF (1)

AA Sequence

MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKAGRAGAGMPPYHRRVGMVQELLRMVRQGRR      1 - 70
EEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKPEGDALGAMEKLCRQL     71 - 140
TYHLSPHSQWRRHRGLVKRKPQACLKAVLAGSPPDNTVDLSGIPLTSRDLERVTSYLQRCGEQVDSVELG    141 - 210
FTGLTDDMVLQLLPALSTLPRLTTLALNGNRLTRAVLRDLTDILKDPSKFPNVTWIDLGNNVDIFSLPQP    211 - 280
FLLSLRKRSPKQGHLPTILELGEGPGSGEEVREGTVGQEDPGGGPVAPAEDHHEGKETVAAAQT          281 - 344
//

Text Mined References (5)

PMID Year Title