Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.71
PubTator Score 3.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.294 0.004
group 3 medulloblastoma 1.300 0.008
adrenocortical carcinoma 1.367 0.000

Synonym

Accession Q8NA72 B4DJG7 Q494X7 Q494X9 Q6P085
Symbols C5orf37

Gene

Gene RIF (3)

PMID Text
25642776 Mutations in the POC5 gene contribute to the occurrence of idiopathic scoliosis.
23844208 Data indicate that overexpression of the centrin interactor POC5 leads to the assembly of linear, centrin-dependent structures.
19349582 hPOC5, a conserved centrin-binding protein that contains Sfi1p-like repeats is characterized.

AA Sequence

MSSDEEKYSLPVVQNDSSRGSSVSSNLQEEYEELLHYAIVTPNIEPCASQSSHPKGELVPDVRISTIHDI      1 - 70
LHSQGNNSEVRETAIEVGKGCDFHISSHSKTDESSPVLSPRKPSHPVMDFFSSHLLADSSSPATNSSHTD     71 - 140
AHEILVSDFLVSDENLQKMENVLDLWSSGLKTNIISELSKWRLNFIDWHRMEMRKEKEKHAAHLKQLCNQ    141 - 210
INELKELQKTFEISIGRKDEVISSLSHAIGKQKEKIELMRTFFHWRIGHVRARQDVYEGKLADQYYQRTL    211 - 280
LKKVWKVWRSVVQKQWKDVVERACQARAEEVCIQISNDYEAKVAMLSGALENAKAEIQRMQHEKEHFEDS    281 - 350
MKKAFMRGVCALNLEAMTIFQNRNDAGIDSTNNKKEEYGPGVQGKEHSAHLDPSAPPMPLPVTSPLLPSP    351 - 420
PAAVGGASATAVPSAASMTSTRAASASSVHVPVSALGAGSAATAASEEMYVPRVVTSAQQKAGRTITARI    421 - 490
TGRCDFASKNRISSSLAIMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSA    491 - 560
HTQSLTSVHSIKVVD                                                           561 - 575
//

Text Mined References (17)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25642776 2015 Functional variants of POC5 identified in patients with idiopathic scoliosis.
25416956 2014 A proteome-scale map of the human interactome network.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
23844208 2013 Calcium-binding capacity of centrin2 is required for linear POC5 assembly but not for nucleotide excision repair.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...