Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.81
PubTator Score 3.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
adrenocortical carcinoma 1428 7.0e-07
osteosarcoma 7950 4.0e-03
group 3 medulloblastoma 4104 7.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Obesity 678 0.0 0.8
Disease Target Count Z-score Confidence
Idiopathic scoliosis 31 3.736 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma 1.367 7.0e-07
group 3 medulloblastoma 1.300 7.6e-03
osteosarcoma -1.294 4.0e-03

Gene RIF (4)

AA Sequence

MSSDEEKYSLPVVQNDSSRGSSVSSNLQEEYEELLHYAIVTPNIEPCASQSSHPKGELVPDVRISTIHDI      1 - 70
LHSQGNNSEVRETAIEVGKGCDFHISSHSKTDESSPVLSPRKPSHPVMDFFSSHLLADSSSPATNSSHTD     71 - 140
AHEILVSDFLVSDENLQKMENVLDLWSSGLKTNIISELSKWRLNFIDWHRMEMRKEKEKHAAHLKQLCNQ    141 - 210
INELKELQKTFEISIGRKDEVISSLSHAIGKQKEKIELMRTFFHWRIGHVRARQDVYEGKLADQYYQRTL    211 - 280
LKKVWKVWRSVVQKQWKDVVERACQARAEEVCIQISNDYEAKVAMLSGALENAKAEIQRMQHEKEHFEDS    281 - 350
MKKAFMRGVCALNLEAMTIFQNRNDAGIDSTNNKKEEYGPGVQGKEHSAHLDPSAPPMPLPVTSPLLPSP    351 - 420
PAAVGGASATAVPSAASMTSTRAASASSVHVPVSALGAGSAATAASEEMYVPRVVTSAQQKAGRTITARI    421 - 490
TGRCDFASKNRISSSLAIMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSA    491 - 560
HTQSLTSVHSIKVVD                                                           561 - 575
//

Text Mined References (18)

PMID Year Title