Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.7e-10
medulloblastoma, large-cell 6241 1.5e-04
Disease Target Count Z-score Confidence
Infertility 188 3.909 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.5e-04
ovarian cancer 1.200 1.7e-10

 GO Function (1)

AA Sequence

MESEDTKKTQEMKTDLNLLLECLKYQMDNAFSQKEALVTIHSICQQNSNASVYFREIGGLMFVKNLAKSS      1 - 70
EHSMVKEAALYTLGAIAEKNVYCQQTLCTSELFEDLTWFLSNDSNINLKRMSVYVILVLVSNNRTGQTLV     71 - 140
RETGCITVLSRLFRTVISKHELDLSDKNVFQSYQLWSSVCSTLCVCVNNPQNDENQMFCCSLFPHANEWL    141 - 210
KNCTTPEIIRPICSFIGLTLANNTYVQKYFVSVGGLDVLSQVLMQLESDSHETLSSAKLAVVVTKTVDAC    211 - 280
IADNPTFGIVLSKYHIVSKLLALLLHESLDSGEKFSIMLTLGHCTEDCEENQYDLFKNNGLPLMIQALTE    281 - 350
SQNEELNKAATFVLHNCKKITEKLSLSLGEYPFDENETQQLKDISVKENNLEEHWRKAKEILHRIEQLER    351 - 420
EGNEEEIQRENYQDNISSMNISIQNTWKHLHADRIGRGSKAEDEDKSHSRQLQSYKSHGVMSKACTNDDQ    421 - 490
MKTPLKSANPVHACYRESEQNKTLYKAKSSCNQNLHEETTFEKNFVSQSSDHVFKHPVHIAKNIKQQLPV    491 - 560
TDPFTLCSDIINKEVVSFLATPSCSEMLTYRCSGCIAVEKSLNSRNFSKLLHSCPYQCDRHKVIVEAEDR    561 - 630
YKSELRKSLICNKKILLTPRRRQRLSNESTTPGGIKKRRIRKNFTEEEVNYLFNGVKKMGNHWNSILWSF    631 - 700
PFQQGRKAVDLAHKYHKLTKHPTCAAS                                               701 - 727
//

Text Mined References (5)

PMID Year Title