Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.28
PubTator Score 0.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8519 1.9e-10
ependymoma 4679 2.0e-05
osteosarcoma 7950 1.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.100 2.0e-05
osteosarcoma 1.021 1.8e-04
ovarian cancer 1.600 1.9e-10

AA Sequence

MPLEERRSSGERNDAAPTNHRRPGEKRASTAKQVSSVPFLGAAGHQQSLPSSWKASCSGPLVMASDSDVK      1 - 70
MLLNFVNLASSDIKAALDKSAPCRRSVDHRKYLQKQLKRFSQKYSRLPRGLPGRAAEPYLKRGSEDRPRR     71 - 140
LLLDLGPDSSPGGGGGCKEKVLRNPYREECLAKEQLPQRQHPEAAQPGQVPMRKRQLPASFWEEPRPTHS    141 - 210
YHVGLEGGLGPREGPPYEGKKNCKGLEPLGPETTLVSMSPRALAEKEPLKMPGVSLVGRVNAWSCCPFQY    211 - 280
HGQPIYPGPLGALPQSPVPSLGLWRKSPAFPGELAHLCKDVDGLGQKVCRPVVLKPIPTKPAVPPPIFNV    281 - 350
FGYL                                                                      351 - 354
//

Text Mined References (6)

PMID Year Title