Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.3e-03
psoriasis 6694 4.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 1.3e-03
psoriasis -1.300 4.4e-03

Synonym

Accession Q8N9U9
Symbols CXorf18

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MASPFGRLTDQKGRGHPAGSGGVEVNGGSARAAFSGGGRRVLSGGGRTAFGGGGRTAFGDGGRTAFGVGG      1 - 70
RTAFGGGGRTAFGGGGRTAFGVGGRTAFGGGERVSLLSPGWSALARSWLTASSASRVQAILLPQPPE        71 - 137
//

Text Mined References (2)

PMID Year Title