Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 0.001
psoriasis -1.300 0.004

Synonym

Accession Q8N9U9
Symbols CXorf18

 Compartment GO Term (0)

AA Sequence

MASPFGRLTDQKGRGHPAGSGGVEVNGGSARAAFSGGGRRVLSGGGRTAFGGGGRTAFGDGGRTAFGVGG      1 - 70
RTAFGGGGRTAFGGGGRTAFGVGGRTAFGGGERVSLLSPGWSALARSWLTASSASRVQAILLPQPPE        71 - 137
//

Text Mined References (2)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.