1. Home
  2. Targets
  3. Protein SREK1IP1

Tdark Protein SREK1IP1

Possible splicing regulator involved in the control of cellular survival.

 Comments

Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.75
PubTator Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.44623216379704E-15
hepatocellular carcinoma 550 2.01355436938423E-6
ovarian cancer 8492 4.51956090903934E-6
primitive neuroectodermal tumor 3031 1.03403041981201E-4
group 4 medulloblastoma 1875 2.036029591922E-4
psoriasis 6685 4.34872010511099E-4
gastric cancer 436 7.9232365015929E-4
invasive ductal carcinoma 2950 0.00250769766508563
osteosarcoma 7933 0.00413365587618885
atypical teratoid / rhabdoid tumor 4369 0.00507511109519192
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00864305725638487
lung cancer 4473 0.0291998413504752

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.100 0.001
hepatocellular carcinoma 1.100 0.000
psoriasis -1.600 0.000
osteosarcoma 1.299 0.004
atypical teratoid / rhabdoid tumor 1.400 0.005
group 4 medulloblastoma 1.400 0.000
primitive neuroectodermal tumor 1.200 0.000
non-small cell lung cancer -1.056 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.009
lung cancer -1.200 0.029
invasive ductal carcinoma -1.400 0.003
ovarian cancer -1.800 0.000

Synonym

Accession Q8N9Q2 Q32NC8
Symbols P18SRP
SFRS12IP1

Gene

SREK1IP1

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 GO Function (2)

 GO Process (2)

 Compartment GO Term (2)

 HCA RNA Cell Line (56)

See all...

Pathway (1)

 UniProt Keyword (8)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15456940 p18SRP is a lysine-rich zinc finger domain-containing protein that interacts with the serine-arginine-rich splicing regulatory protein SRrp86; it is downregulated in brain of Alzheimer disease patients.

AA Sequence 

MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRI      1 - 70
NEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKKSKSKKGKHHKKEKKKRKK     71 - 140
EKHSSTPNSSEFSRK                                                           141 - 155
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456940 2004 The splicing regulatory protein p18SRP is down-regulated in Alzheimer's disease brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.