Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.75
PubTator Score 1.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.3e-02
gastric cancer 1.100 7.9e-04
group 4 medulloblastoma 1.100 4.5e-04
hepatocellular carcinoma 1.100 2.0e-06
intraductal papillary-mucinous neoplasm ... 1.100 8.6e-03
invasive ductal carcinoma -1.400 2.5e-03
lung cancer -1.200 2.9e-02
non-small cell lung cancer -1.056 1.4e-15
osteosarcoma 1.299 4.1e-03
ovarian cancer -1.800 4.5e-06
primitive neuroectodermal tumor 1.200 1.0e-04
psoriasis -1.600 4.3e-04

Synonym

Accession Q8N9Q2 Q32NC8
Symbols P18SRP
SFRS12IP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRI      1 - 70
NEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKKSKSKKGKHHKKEKKKRKK     71 - 140
EKHSSTPNSSEFSRK                                                           141 - 155
//

Text Mined References (9)

PMID Year Title