Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.75
PubTator Score 1.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.100 0.001
hepatocellular carcinoma 1.100 0.000
psoriasis -1.600 0.000
osteosarcoma 1.299 0.004
atypical teratoid / rhabdoid tumor 1.400 0.005
group 4 medulloblastoma 1.400 0.000
primitive neuroectodermal tumor 1.200 0.000
non-small cell lung cancer -1.056 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.009
lung cancer -1.200 0.029
invasive ductal carcinoma -1.400 0.003
ovarian cancer -1.800 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15456940 p18SRP is a lysine-rich zinc finger domain-containing protein that interacts with the serine-arginine-rich splicing regulatory protein SRrp86; it is downregulated in brain of Alzheimer disease patients.

AA Sequence

MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRI      1 - 70
NEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKKSKSKKGKHHKKEKKKRKK     71 - 140
EKHSSTPNSSEFSRK                                                           141 - 155
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456940 2004 The splicing regulatory protein p18SRP is down-regulated in Alzheimer's disease brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.