Knowledge Summary

Patent

No data available

Synonym

Accession Q8N9P0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTSVASLPEQSPGYRCRSLTGAGARTSAAGPLARLLPRRRLPPPHLPARPPGGWSRNQSHQRRGPGRCWG      1 - 70
WGRGMTRICPLCPGAPEYINSAVSSQTLSQSCTPPQSPQPDPRPLSLRVGLALPGGRLGCGEAGSANRHW     71 - 140
FSFLFPFIHFCWSPRAAAPGVAMNGWMPARWDHQVRRDVAGARGAPPAWGQAPSPRRSVGGPQKTLKRPK    141 - 210
ACSPRSPQHTPGVFSAPEKLGRKT                                                  211 - 234
//

Text Mined References (3)

PMID Year Title