Knowledge Summary

Patent

No data available

Synonym

Accession Q8N9P0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTSVASLPEQSPGYRCRSLTGAGARTSAAGPLARLLPRRRLPPPHLPARPPGGWSRNQSHQRRGPGRCWG      1 - 70
WGRGMTRICPLCPGAPEYINSAVSSQTLSQSCTPPQSPQPDPRPLSLRVGLALPGGRLGCGEAGSANRHW     71 - 140
FSFLFPFIHFCWSPRAAAPGVAMNGWMPARWDHQVRRDVAGARGAPPAWGQAPSPRRSVGGPQKTLKRPK    141 - 210
ACSPRSPQHTPGVFSAPEKLGRKT                                                  211 - 234
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.