Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.4e-02

AA Sequence

MAEKPHQNSCNSVRQLFKTKQLVTHRDRGSCTHRAQGLLAARTTALQRSPLQQEIWESTTALNLPSALAP      1 - 70
QGLTAKDAHFLGDTDPIQEGARDHAAGGPFQDRQASVAAQTLSWERGQGFSRHHGNHLLYSH             71 - 132
//

Text Mined References (4)

PMID Year Title