Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.10
PubTator Score 20.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 7.1e-05
astrocytic glioma -1.400 1.2e-03
Astrocytoma, Pilocytic -1.500 1.9e-07
atypical teratoid / rhabdoid tumor -1.800 1.6e-08
ductal carcinoma in situ -1.800 9.7e-05
fibroadenoma -2.200 2.8e-02
glioblastoma -1.200 1.3e-05
group 3 medulloblastoma -1.800 1.5e-05
invasive ductal carcinoma -1.800 1.2e-03
medulloblastoma, large-cell -1.900 1.7e-05
primitive neuroectodermal tumor -1.300 2.3e-04
psoriasis -1.200 5.8e-25

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPVAQPHGGAGGA      1 - 70
GPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLLYALLAALCFAVSRSLLLTCL     71 - 140
VPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVEL    141 - 210
LRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTL    211 - 280
SLAERLFFQVRYHRYRLQLREE                                                    281 - 302
//

Text Mined References (17)

PMID Year Title