Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $58,687.5
PubMed Score 18.29
PubTator Score 20.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 0.001
glioblastoma -1.800 0.000
sonic hedgehog group medulloblastoma -2.600 0.000
atypical teratoid/rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.600 0.000
fibroadenoma -2.200 0.028
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.500 0.000
ductal carcinoma in situ -2.300 0.001
invasive ductal carcinoma -2.000 0.018
psoriasis -1.200 0.000

Synonym

Accession Q8N9F0 NAA synthetase
Symbols CML3
NACED
NAT8-LIKE

Gene

 Grant Application (1)

Gene RIF (6)

PMID Text
26550943 Characterization and recombinant expression of the nat8l gene that codes for ANAT.
26511490 NAA is produced specifically in NSCLC tumors through NAT8L overexpression, and its extracellular secretion can be detected in blood
24246274 This study demonistrated that the human NAT8L gene related to reward dependence, a personality trait, and grey matter volume in the caudate nucleus in healthy subjects, suggesting that NAT8L might also affect human personality
24155240 Nat8l impacts on the brown adipogenic phenotype
21936773 The aim of the present study was to determine which regions of the protein are important for its catalytic activity and its subcellular localization.
19807691 Results indicated that NAT8L, but not NAT14, catalysed the synthesis of NAA from L-aspartate and acetyl-CoA.

AA Sequence

MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPVAQPHGGAGGA      1 - 70
GPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLLYALLAALCFAVSRSLLLTCL     71 - 140
VPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVEL    141 - 210
LRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTL    211 - 280
SLAERLFFQVRYHRYRLQLREE                                                    281 - 302
//

Text Mined References (16)

PMID Year Title
26550943 2016 Purification and characterization of aspartate N-acetyltransferase: A critical enzyme in brain metabolism.
26511490 2016 Cancer-Specific Production of N-Acetylaspartate via NAT8L Overexpression in Non-Small Cell Lung Cancer and Its Potential as a Circulating Biomarker.
24246274 2014 Deletion of SHATI/NAT8L increases dopamine D1 receptor on the cell surface in the nucleus accumbens, accelerating methamphetamine dependence.
24155240 2013 NAT8L (N-acetyltransferase 8-like) accelerates lipid turnover and increases energy expenditure in brown adipocytes.
24105954 2013 SHATI/NAT8L regulates neurite outgrowth via microtubule stabilization.
21936773 2012 Determinants of the enzymatic activity and the subcellular localization of aspartate N-acetyltransferase.
20643647 2010 Molecular characterization of N-acetylaspartylglutamate synthetase.
20385109 2010 Methamphetamine-induced neuronal protein NAT8L is the NAA biosynthetic enzyme: implications for specialized acetyl coenzyme A metabolism in the CNS.
19807691 2009 Molecular identification of aspartate N-acetyltransferase and its mutation in hypoacetylaspartia.
19524112 2009 Evidence for mitochondrial and cytoplasmic N-acetylaspartate synthesis in SH-SY5Y neuroblastoma cells.
More...