Property Summary

NCBI Gene PubMed Count 4
PubMed Score 39.84
PubTator Score 19.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N9B4 Q49A49
Symbols SARP
PPP1R79

Gene

  Ortholog (9)

Species Source
Chimp EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog EggNOG Inparanoid
Horse EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken EggNOG Inparanoid
Anole lizard EggNOG Inparanoid

Gene RIF (1)

PMID Text
17123353 the cloning and characterization of a new protein, termed SARP (several ankyrin repeat protein), which is shown to interact with all isoforms of PP1 by a variety of techniques.

AA Sequence

MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITHVTTRGWTASH      1 - 70
IAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAF     71 - 140
HGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFKFLVSRMSSATQVLKAFNDNGENVLDLAQR    141 - 210
FFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQ    211 - 280
GHIECLQWLIKMGADSNITNKAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVE    281 - 350
GSTDAKDDLCLSDLDKTDARRPSKNCRASWSMNDYVEKN                                   351 - 389
//

Text Mined References (4)

PMID Year Title
17123353 2007 SARP, a new alternatively spliced protein phosphatase 1 and DNA interacting protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.