Property Summary

NCBI Gene PubMed Count 4
Grant Count 40
R01 Count 13
Funding $10,842,285.59
PubMed Score 39.84
PubTator Score 19.93

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
17123353 the cloning and characterization of a new protein, termed SARP (several ankyrin repeat protein), which is shown to interact with all isoforms of PP1 by a variety of techniques.

AA Sequence

MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITHVTTRGWTASH      1 - 70
IAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAF     71 - 140
HGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFKFLVSRMSSATQVLKAFNDNGENVLDLAQR    141 - 210
FFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQ    211 - 280
GHIECLQWLIKMGADSNITNKAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVE    281 - 350
GSTDAKDDLCLSDLDKTDARRPSKNCRASWSMNDYVEKN                                   351 - 389
//

Text Mined References (4)

PMID Year Title
17123353 2007 SARP, a new alternatively spliced protein phosphatase 1 and DNA interacting protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.