Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.14
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N945 G5EA01 Q96EQ3
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MGVSVDVHQVYKYPFEQVVASFLRKYPNPMDKNVISVKIMEEKRDESTGVIYRKRIAICQNVVPEILRKS      1 - 70
LSTLVILCWKKVSILKVPNIQLEEESWLNPRERNMAIRSHCLTWTQYASMKEESVFRESMENPNWTEFIQ     71 - 140
RGRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE                         141 - 189
//

Text Mined References (8)

PMID Year Title