Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q8N910
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MPRAGRAPAEGGPAPGTRSSRCLRPRPLAWRRLVPNFGAWAPRKGAARVGRPVLSPRTSGAAGEPTCGAG      1 - 70
SPGTLEEGVASGRTRRRTQSAGEVAKCRWGLGQEPLCPRGAVLLNSFSPPAWPQFPPALRLRALAWPQPR     71 - 140
GPACGSTAQWPPRGDPTWRIS                                                     141 - 161
//

Text Mined References (2)

PMID Year Title