Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.26820010164656E-9
glioblastoma 5572 1.18585343680557E-4
medulloblastoma, large-cell 6234 2.94339485311237E-4
adult high grade glioma 2148 0.00536315441192645
atypical teratoid / rhabdoid tumor 4369 0.00686879731591365

Synonym

Accession Q8N910
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MPRAGRAPAEGGPAPGTRSSRCLRPRPLAWRRLVPNFGAWAPRKGAARVGRPVLSPRTSGAAGEPTCGAG      1 - 70
SPGTLEEGVASGRTRRRTQSAGEVAKCRWGLGQEPLCPRGAVLLNSFSPPAWPQFPPALRLRALAWPQPR     71 - 140
GPACGSTAQWPPRGDPTWRIS                                                     141 - 161
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.