Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.300 3.5e-03
intraductal papillary-mucinous carcinoma... 1.400 7.2e-03
osteosarcoma -1.334 7.5e-04
ovarian cancer -1.100 2.2e-05

AA Sequence

MESSRWDKDPPGERRPQQSQHWRARDHGARGCGPRQPTATASPRPGLWITPAHGSHTPQTNTRRTQADNI      1 - 70
FIYESWLIHHGTQMSSVLPQPPLVRGPWHNTNSPWDSWASRGKLRVCPCRTPRLHSSGCFSSKAGTALSP     71 - 140
SLPVPGLRPQPPFLQKPLSILAPATPPALVSPTPPKLSPGQLSPHSVNVHWGPQGHLHLPRSGTTVLHAY    141 - 210
LQTLSSPASHQ                                                               211 - 221
//

Text Mined References (4)

PMID Year Title