Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.2092925358574E-5
osteosarcoma 7933 7.54070795299034E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00348461793615127
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00719101316903932

Expression

  Differential Expression (4)

AA Sequence

MESSRWDKDPPGERRPQQSQHWRARDHGARGCGPRQPTATASPRPGLWITPAHGSHTPQTNTRRTQADNI      1 - 70
FIYESWLIHHGTQMSSVLPQPPLVRGPWHNTNSPWDSWASRGKLRVCPCRTPRLHSSGCFSSKAGTALSP     71 - 140
SLPVPGLRPQPPFLQKPLSILAPATPPALVSPTPPKLSPGQLSPHSVNVHWGPQGHLHLPRSGTTVLHAY    141 - 210
LQTLSSPASHQ                                                               211 - 221
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.