Property Summary

NCBI Gene PubMed Count 15
PubMed Score 19.45
PubTator Score 6.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

AA Sequence

MEEQVFKGDPDTPHSISFSGSGFLSFYQAGAVDALRDLAPRMLETAHRFAGTSAGAVIAALAICGIEMDE      1 - 70
YLRVLNVGVAEVKKSFLGPLSPSCKMVQMMRQFLYRVLPEDSYKVTTGKLHVSLTRLTDGENVVVSEFTS     71 - 140
KEELIEALYCSCFVPVYCGLIPPTYRGVRYIDGGFTGMQPCAFWTDAITISTFSGQQDICPRDCPAIFHD    141 - 210
FRMFNCSFQFSLENIARMTHALFPPDLVILHDYYYRGYEDAVLYLRRLNAVYLNSSSKRVIFPRVEVYCQ    211 - 280
IELALGNECPERSQPSLRARQASLEGATQPHKEWVPKGDGRGSHGPPVSQPVQTLEFTCESPVSAPVSPL    281 - 350
EQPPAQPLASSTPLSLSGMPPVSFPAVHKPPSSTPGSSLPTPPPGLSPLSPQQQVQPSGSPARSLHSQAP    351 - 420
TSPRPSLGPSTVGAPQTLPRSSLSAFPAQPPVEELGQEQPQAVALLVSSKPKSAVPLVHVKETVSKPYVT    421 - 490
ESPAEDSNWVNKVFKKNKQKTSGTRKGFPRHSGSKKPSSKVQ                                491 - 532
//

Text Mined References (16)

PMID Year Title