Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MVLLCLFLASLAATPRAGVTGAWPTSGLSILAQLQPSCELRWTQLSRSSWRDLVMTTSLWSLAYFQHFSQ      1 - 70
ETTTQEQLDEMEEIPRESQCGRQDFHALSCPTASPRDRVLLCCPGWRAMVPS                       71 - 122
//

Text Mined References (2)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.