Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.25
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
pilocytic astrocytoma 3,086
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
pilocytic astrocytoma 1.200 0.000
psoriasis -3.400 0.000

AA Sequence

MKLEASCGTATSEVPKPEKKTARDAEPSSETRPQEVEAEPRSGSGPEAEAEPLDFVVATEREFEEVLAIS      1 - 70
GGIYGGLDYLPSRYHSWLRDPDRTVVLAKRNGGVIALESVNVIDAGETVLVEGLRVAPWERGKGVAGLLQ     71 - 140
RFCSQLVKRQHPGVKVARLTRDDQLGPRELKKYRLITKQGILLVRFNASALLAGLGARLAALRTSGTFSP    141 - 210
LPTEAVSEAGGDVARLLLSPSVQRDVLPGGTIIQDWQPYRPSESNLRLLAAKGLEWRVDSRARPRVLTLC    211 - 280
TRPFPIPHGGDGTWRYLNIDAFGSDGAQVQSQLLWHLQRQAPRLVGLNVMCQLFLEPQLWSQLADFCQVG    281 - 350
LGLELVKGYTEQYLLEADI                                                       351 - 369
//

Text Mined References (7)

PMID Year Title
24121108 2014 An ectotherm homologue of human predicted gene NAT16 encodes histidine N-acetyltransferase responsible for N?-acetylhistidine synthesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.