Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.8e-06
psoriasis 6694 9.5e-04

Expression

 Compartment GO Term (0)

AA Sequence

MEVKFITGKHGGRRPQRAEPQRICRALWLTPWPSLILKLLSWIILSNLFLHLRATHHMTELPLRFLYIAL      1 - 70
SEMTFREQTSHQIIQQMSLSNKLEQNQLYGEVINKETDNPVISSGLTLLFAQKPQSPGWKNMSSTKRVCT     71 - 140
ILADSCRAQAHAADRGERGHFGVQILHHFIEVFNVMAVRSNPF                               141 - 183
//

Text Mined References (5)

PMID Year Title