Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1158 9.6e-06
osteosarcoma 7950 1.6e-04

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy -1.520 9.6e-06
osteosarcoma -1.410 1.6e-04

AA Sequence

MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIV      1 - 70
LIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN              71 - 131
//

Text Mined References (7)

PMID Year Title