Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.61
PubTator Score 0.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.53821844476851E-25
non-small cell lung cancer 2798 4.32155960484699E-17
tuberculosis and treatment for 3 months 327 3.41815031552708E-7
osteosarcoma 7933 1.09468892298678E-5
invasive ductal carcinoma 2950 8.82295045328359E-5
ovarian cancer 8492 1.21187805487457E-4
primary Sjogren syndrome 789 1.75395528971752E-4
ulcerative colitis 2087 2.75687214461776E-4
head and neck cancer 270 4.84979495096707E-4
pilocytic astrocytoma 3086 9.08754977203001E-4
Rheumatoid Arthritis 1171 0.00322939023081678
sarcoidosis 368 0.00477622625425906
interstitial cystitis 2299 0.00478696607421778
primitive neuroectodermal tumor 3031 0.00850016571712713
adult high grade glioma 2148 0.0114712382379165
atypical teratoid / rhabdoid tumor 4369 0.0311692022264363
progressive supranuclear palsy 674 0.0441592199512196
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0447915919517989
Disease Target Count Z-score Confidence
Intracranial aneurysm 20 0.0 2.0

Expression

Synonym

Accession Q8N8A2 Q53SL9 Q6P480 Q86VL5 Q8IZ72 Q9UFA4 PP6-ARS-B
Symbols PP6-ARS-B

Gene

 Compartment GO Term (2)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVLKLTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAK      1 - 70
DNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGG     71 - 140
RTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPL    141 - 210
HAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAA    211 - 280
ASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYG    281 - 350
HELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVEC    351 - 420
IKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAASDMDRNKTIL    421 - 490
GNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNSGFE    491 - 560
ESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALDLAAFKGHTECVEALINQGASIFVKD    561 - 630
NVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVD    631 - 700
ILGCTALHRGIMTGHEECVQMLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDN    701 - 770
QGYTPLHWACYNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGR    771 - 840
TPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPL    841 - 910
HLACSKGHEKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEELLAKGACVLAVDENASRSNG    911 - 980
PRSTPGTAVQKEE                                                             981 - 993
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18186651 2008 Protein phosphatase 6 regulatory subunits composed of ankyrin repeat domains.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...