Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.61
PubTator Score 0.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.100 1.1e-02
Astrocytoma, Pilocytic 1.300 6.1e-04
atypical teratoid / rhabdoid tumor -1.100 3.1e-02
head and neck cancer -1.300 5.8e-04
interstitial cystitis 1.500 4.8e-03
intraductal papillary-mucinous carcinoma... -1.100 4.5e-02
invasive ductal carcinoma 1.244 8.8e-05
lung carcinoma -1.800 4.5e-25
non-small cell lung cancer -1.908 4.3e-17
osteosarcoma -1.511 2.3e-03
ovarian cancer -2.300 1.2e-04
primary Sjogren syndrome 2.000 1.8e-04
primitive neuroectodermal tumor 1.200 8.5e-03
progressive supranuclear palsy -1.100 4.4e-02
Rheumatoid arthritis 1.700 3.2e-03
sarcoidosis 1.400 4.8e-03
tuberculosis 1.100 1.3e-06
ulcerative colitis 2.000 2.8e-04

 Compartment GO Term (2)

Gene RIF (2)

AA Sequence

MAVLKLTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAK      1 - 70
DNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGG     71 - 140
RTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPL    141 - 210
HAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAA    211 - 280
ASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYG    281 - 350
HELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVEC    351 - 420
IKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAASDMDRNKTIL    421 - 490
GNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNSGFE    491 - 560
ESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALDLAAFKGHTECVEALINQGASIFVKD    561 - 630
NVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVD    631 - 700
ILGCTALHRGIMTGHEECVQMLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDN    701 - 770
QGYTPLHWACYNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGR    771 - 840
TPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPL    841 - 910
HLACSKGHEKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEELLAKGACVLAVDENASRSNG    911 - 980
PRSTPGTAVQKEE                                                             981 - 993
//

Text Mined References (15)

PMID Year Title