Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.058 4.3e-05
adult high grade glioma -1.200 4.8e-06
astrocytic glioma -1.400 2.4e-02
Astrocytoma, Pilocytic -1.200 1.3e-06
atypical teratoid / rhabdoid tumor -1.200 9.3e-05
ependymoma -1.400 4.4e-02
glioblastoma -1.200 7.2e-07
group 4 medulloblastoma -1.300 6.0e-07
medulloblastoma, large-cell -1.800 8.7e-07
osteosarcoma -1.255 7.6e-04
ovarian cancer 1.300 1.6e-03
Pick disease -1.400 2.0e-04
subependymal giant cell astrocytoma -2.178 5.5e-03

AA Sequence

MFQNLQGTFEKEIGKIIPFTIAFKRAEAVEPDGCVQSWRCCLPCDLGQASRFIHTTVCSAIRWRSCKGER      1 - 70
NFAERHILPAELEEQSNHAGMGPILPAMPSVDGNHFQHPAGDCHPYGILCLQAHSASVTARQVLQ          71 - 135
//

Text Mined References (4)

PMID Year Title