Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.500 0.033
ependymoma -1.400 0.044
osteosarcoma -1.255 0.001
glioblastoma -1.500 0.000
medulloblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -2.300 0.000
adrenocortical carcinoma 1.058 0.000
adult high grade glioma -1.400 0.001
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -2.178 0.006
Pick disease -1.400 0.000
ovarian cancer 1.300 0.002

Synonym

Accession Q8N812
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MFQNLQGTFEKEIGKIIPFTIAFKRAEAVEPDGCVQSWRCCLPCDLGQASRFIHTTVCSAIRWRSCKGER      1 - 70
NFAERHILPAELEEQSNHAGMGPILPAMPSVDGNHFQHPAGDCHPYGILCLQAHSASVTARQVLQ          71 - 135
//

Text Mined References (4)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.