Property Summary

NCBI Gene PubMed Count 8
Grant Count 14
R01 Count 12
Funding $856,492.34
PubMed Score 1.41
PubTator Score 1.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.289 0.007
Multiple myeloma 1.241 0.005
ovarian cancer 2.000 0.000
dermatomyositis 1.200 0.000

Gene RIF (1)

PMID Text
24664117 These data provide the first evidence of ubiquitin ligase activity in mammalian spermatozoa and indicate UBR7 involvement in spermiogenesis.

AA Sequence

MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEE      1 - 70
PAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRP     71 - 140
YPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAVTKISTEDDG    141 - 210
LVRNIDGIGDQEVIKPENGEHQDSTLKEDVPEQGKDDVREVKVEQNSEPCAGSSSESDLQTVFKNESLNA    211 - 280
ESKSGCKLQELKAKQLIKKDTATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQA    281 - 350
TDRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGM    351 - 420
QYYCS                                                                     421 - 425
//

Text Mined References (11)

PMID Year Title
24664117 2014 Identification and characterization of RING-finger ubiquitin ligase UBR7 in mammalian spermatozoa.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18162545 2008 Synthetic heterovalent inhibitors targeting recognition E3 components of the N-end rule pathway.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...