Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.91
PubTator Score 1.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count P-value
dermatomyositis 966 4.9e-04
ovarian cancer 8520 1.5e-03
Multiple myeloma 1332 5.0e-03
Waldenstrons macroglobulinemia 765 6.8e-03

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.200 4.9e-04
Multiple myeloma 1.241 5.0e-03
ovarian cancer -1.300 1.5e-03
Waldenstrons macroglobulinemia 1.289 6.8e-03

Gene RIF (1)

AA Sequence

MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEE      1 - 70
PAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRP     71 - 140
YPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAVTKISTEDDG    141 - 210
LVRNIDGIGDQEVIKPENGEHQDSTLKEDVPEQGKDDVREVKVEQNSEPCAGSSSESDLQTVFKNESLNA    211 - 280
ESKSGCKLQELKAKQLIKKDTATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQA    281 - 350
TDRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGM    351 - 420
QYYCS                                                                     421 - 425
//

Text Mined References (12)

PMID Year Title