Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.11
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

AA Sequence

MMNSDQKAVKFLANFYINGGKHWTHGHLRQTQPEPTQPKASVLLLGPEPGMAWDETQPPKMKEIPVGLRL      1 - 70
QTGTPQESLPTYTQTLRELLLEQRPLITADLEVPSPTRYQVPSPSVRESSPHPHYSIGCKHQGREGGGRR     71 - 140
AWQTLWFQSESPFTQKADFDQEQKWPSPAHYQLLSRPAFPAFSFRGCHSASKTPEGHTHLGLPGARGLGL    141 - 210
RVQPQSLLQASLQAPGKRCPGPNTYNILPGSRLQSPRSPAFSMSRSPAFTSWLSTWLPAFSFGSPNPWPS    211 - 280
RLPRGGLQLTLPFGAWRGHPGCTQTQAPRHRPLLHALEPAGHNLLGPATEWNHGLPRGFPRPPLGLGAPA    281 - 350
WPSDPLGTPMHPSGWPTLLWAVDKAGPAWIPHLPISPLH                                   351 - 389
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.