Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.0e-10

Expression

Synonym

Accession Q8N7Q2 A6NFV2
Symbols C10orf31

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MFCLLHLCFYLANFASSIKRTHAVNGCCGLQMIALWAQSSGNADARVEEILAGEERRLAALLGSQGMRFW      1 - 70
VCLAACRAMWGLAARRGRAEDSSSSPVDASKFPWRGGQHRTTMMPCLLRVGVFRPCHVRPTGDPSCDVQP     71 - 140
PRLGFSRVPDTQVAFYGSGHWDPTPFSVHSCFFNFQVRKIIFLL                              141 - 184
//

Text Mined References (3)

PMID Year Title