Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.19
PubTator Score 2.53

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
20657603 A novel RING finger protein, ZNF645, which is expressed specifically in human testis and sperm and has E3 ubiquitin ligase activity.

AA Sequence

MNKMPAGEQECEYNKEGKYYSKGVKLVRKKKKIPGYRWGDIKINIIGEKDDLPIHFCDKCDLPIKIYGRI      1 - 70
IPCKHAFCYHCANLYDKVGYKVCPRCRYPVLRIEAHKRGSVFMCSIVQQCKRTYLSQKSLQAHIKRRHKR     71 - 140
ARKQVTSASLEKVRPHIAPPQTEISDIPKRLQDRDHLSYIPPEQHTMVSLPSVQHMLQEQHNQPHKDIQA    141 - 210
PPPELSLSLPFPIQWETVSIFTRKHGNLTVDHIQNNSDSGAKKPTPPDYYPECQSQPAVSSPHHIIPQKQ    211 - 280
HYAPPPSPSSPVNHQMPYPPQDVVTPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPPLRAPQSQNGNP    281 - 350
SASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQR    351 - 420
RHRRY                                                                     421 - 425
//

Text Mined References (8)

PMID Year Title
22252131 2012 Structure of a novel phosphotyrosine-binding domain in Hakai that targets E-cadherin.
20657603 2010 Human RING finger protein ZNF645 is a novel testis-specific E3 ubiquitin ligase.
20587329 2010 Promoter demethylation mediates the expression of ZNF645, a novel cancer/testis gene.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.