Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.08
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 4.6e-03

Gene RIF (2)

AA Sequence

MVCGIQEAAENYRKLFQEILNTSREKLEAAKSILTDEQERMAMIQEEEQNFKKMIESEYSMRLRLLNEEC      1 - 70
EQNLQRQQECISDLNLRETLLNQAIKLATELEEMFQEMLQRLGRVGRENMEKLKESEARASEQVRSLLKL     71 - 140
IVELEKKCGEGTLALLKNAKYSLERSKSLLLEHLEPAHITDLSLCHIRGLSSMFRVLQRHLTLDPETAHP    141 - 210
CLALSEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKATRWQVGIYHGSADAKGS    211 - 280
TARASGEKVLLTGSVMGTEWTLWVFPPLKRLFLEKKLDTVGVFLDCEHGQISFYNVTEMSLIYNFSHCAF    281 - 350
QGALRPVFSLCIPNGDTSPDSLTILQHGPSCDATVSP                                     351 - 387
//

Text Mined References (8)

PMID Year Title