Property Summary

NCBI Gene PubMed Count 17
Grant Count 19
R01 Count 10
Funding $1,228,725.01
PubMed Score 86.04
PubTator Score 18.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 3.900 0.001

Gene RIF (6)

PMID Text
26536090 our data highlight that NPW modulates the CaV1.2 currents via G protein-coupled receptor 7, and the presence of it influences arterial tone.
25270269 these studies indicated an inconsistency between plasma and gastric NPW expression in response to nutrient ingestion, suggesting food induced gastric NPW expression may play a more important role locally
22826747 This review of NPW suggests that study of effects of this peptide may reveal its role in regulating feeding and energy metabolism coupled to leptin levels in the brain.
12959997 Intracerebroventricular administration of NPW23 and NPW30 to free-feeding rats suppressed dark phase and fasting-induced food intake. Possibly NPW functions as an endogenous catabolic signaling molecule in the brain.
12719537 a non-AUG translation initiation site is used to express mouse prepro-Npw
12130646 determined that non-AUG translation initiation is used to express human prepro-NPW

AA Sequence

MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPYLWRRALRAAA      1 - 70
GPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLR     71 - 140
RDVSRPAVDPAANRLGLPCLAPGPF                                                 141 - 165
//

Text Mined References (17)

PMID Year Title
26536090 2015 Modulation of CaV1.2 calcium channel by neuropeptide W regulates vascular myogenic tone via G protein-coupled receptor 7.
25270269 2014 Gastric neuropeptide W is regulated by meal-related nutrients.
22826747 2011 Analgesic neuropeptide W suppresses seizures in the brain revealed by rational repositioning and peptide engineering.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16847439 2006 Neuropeptide B and W: neurotransmitters in an emerging G-protein-coupled receptor system.
16394174 2006 Neuropeptide W is present in antral G cells of rat, mouse, and human stomach.
16273281 2005 Neuropeptides B and W enhance the growth of human adrenocortical carcinoma-derived NCI-H295 cells by exerting MAPK p42/p44-mediated proliferogenic and antiapoptotic effects.
15797961 2005 G protein receptors 7 and 8 are expressed in human adrenocortical cells, and their endogenous ligands neuropeptides B and w enhance cortisol secretion by activating adenylate cyclase- and phospholipase C-dependent signaling cascades.
12959997 2003 A role for neuropeptide W in the regulation of feeding behavior.
More...