Property Summary

NCBI Gene PubMed Count 17
PubMed Score 90.20
PubTator Score 18.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 3.900 8.7e-04

Synonym

Accession Q8N729
Symbols L8
L8C
PPL8
PPNPW

Gene

NPW

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (6)

AA Sequence

MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPYLWRRALRAAA      1 - 70
GPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLR     71 - 140
RDVSRPAVDPAANRLGLPCLAPGPF                                                 141 - 165
//

Text Mined References (17)

PMID Year Title