Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.01
PubTator Score 4.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 2.16330031038834E-9
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0
Disease Target Count Z-score Confidence
Trichorhinophalangeal syndrome type I 8 4.135 2.1

Synonym

Accession Q8N6Y1 A8K1K9 B1AQU2 Q8NDN4 Q9NRT9
Symbols PCDH13

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (3)

PMID Text
26188009 Genome-wide association analysis on normal hearing function identifies PCDH20 and SLC28A3 as good candidates for modulatory genes in the auditory system. [meta-analysis]
25736877 Study shows that PCDH20 expression is downregulated in nasopharyngeal carcinoma cells (NPC) and identified it as a functional tumor suppressor and an important antagonist of Wnt/beta-catenin signaling and EMT, with frequent epigenetic inactivation in NPC.
24910204 In conclusion, these data here strongly suggested that PCDH20 may act as a candidate tumour suppressor in hepatocellular carcinoma.

AA Sequence

MRGRGNARSSQALGVSWCPATWHPRLDMGRLHRPRSSTSYRNLPHLFLFFLFVGPFSCLGSYSRATELLY      1 - 70
SLNEGLPAGVLIGSLAEDLRLLPRSAGRPDPQSQLPERTGAEWNPPLSFSLASRGLSGQYVTLDNRSGEL     71 - 140
HTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFVKVKIAIRDINDNAPQFP    141 - 210
VSQISVWVPENAPVNTRLAIEHPAVDPDVGINGVQTYRLLDYHGMFTLDVEENENGERTPYLIVMGALDR    211 - 280
ETQDQYVSIIIAEDGGSPPLLGSATLTIGISDINDNCPLFTDSQINVTVYGNATVGTPIAAVQAVDKDLG    281 - 350
TNAQITYSYSQKVPQASKDLFHLDENTGVIKLFSKIGGSVLESHKLTILANGPGCIPAVITALVSIIKVI    351 - 420
FRPPEIVPRYIANEIDGVVYLKELEPVNTPIAFFTIRDPEGKYKVNCYLDGEGPFRLSPYKPYNNEYLLE    421 - 490
TTKPMDYELQQFYEVAVVAWNSEGFHVKRVIKVQLLDDNDNAPIFLQPLIELTIEENNSPNAFLTKLYAT    491 - 560
DADSEERGQVSYFLGPDAPSYFSLDSVTGILTVSTQLDREEKEKYRYTVRAVDCGKPPRESVATVALTVL    561 - 630
DKNDNSPRFINKDFSFFVPENFPGYGEIGVISVTDADAGRNGWVALSVVNQSDIFVIDTGKGMLRAKVSL    631 - 700
DREQQSSYTLWVEAVDGGEPALSSTAKITILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPVTEVYAV    701 - 770
DKDTGMNAVIAYSIIGRRGPRPESFRIDPKTGNITLEEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMVN    771 - 840
LFVNDTVSNESYIESLLRKEPEINIEEKEPQISIEPTHRKVESVSCMPTLVALSVISLGSITLVTGMGIY    841 - 910
ICLRKGEKHPREDENLEVQIPLKGKIDLHMRERKPMDISNI                                 911 - 951
//

Text Mined References (20)

PMID Year Title
26188009 2015 Genome-wide association analysis on normal hearing function identifies PCDH20 and SLC28A3 as candidates for hearing function and loss.
25736877 2015 Protocadherin20 Acts as a Tumor Suppressor Gene: Epigenetic Inactivation in Nasopharyngeal Carcinoma.
24910204 2015 PCDH20 functions as a tumour-suppressor gene through antagonizing the Wnt/?-catenin signalling pathway in hepatocellular carcinoma.
23212062 2012 Genome-wide association study of clinical dimensions of schizophrenia: polygenic effect on disorganized symptoms.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21907864 2011 Identification of IL6R and chromosome 11q13.5 as risk loci for asthma.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...