Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.70

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAGRSLCLTRSSVPGTPFPPPVQQPSTPGPDLLALEEEYKRLNAELQAKTADVVQQAKEIIRDRQEVRSR      1 - 70
PVSTQMKSCDDEDDYSLRGLLPSEGIVHLHSETKPKTKNIDPVNKVQNKLHSANKGRKTNSSVKLKYSDV     71 - 140
QTADDVAIPEDFSDFSLAKTISKIEGQLEEEGLPEYIDDIFSGVSNDIGTEAQIRFLKAKLHVMQEELDN    141 - 210
VVCECNKKEDEIQNLKSQVKNFEEDFMRQQRTINMQQSQVEKYKTLFEEANKKYDGLQQQLSSVERELEN    211 - 280
KRRLQKQAASSQSATEVRLNRALEEAEKYKLELSKLRQNNKDIANEEHKKIEVLKSENKKLEKQKGELMI    281 - 350
GFKKQLKLIDVLKRQKMHIEAAKMLSFTEEEFMKALEWGNS                                 351 - 391
//

Text Mined References (9)

PMID Year Title