Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.7e-04
adult high grade glioma 3801 3.4e-03

Expression

Synonym

Accession Q8N6U2 B3KW01
Symbols C12orf33

 Compartment GO Term (0)

AA Sequence

MRRCRRCARWPHRCPGPQSGPRSHFSPWPRTLGPAPALCVRTPLRPGPSSALGPLSACPSVPDYTASPPA      1 - 70
GDSARSIVAASRAAGSGSTPGAGSKDCSPPPHSHSAAAAGESGDIGPGSGAVEAPGRGARRPTRQREDGG     71 - 140
GAVGCFGVSRHRGREAQMSHSSHCGSRSCSAAAARPSLLQLA                                141 - 182
//

Text Mined References (3)

PMID Year Title