Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ -1.900 2.0e-04
invasive ductal carcinoma -2.500 5.5e-04
non-small cell lung cancer -1.101 2.5e-15
osteosarcoma -4.896 3.1e-07
ovarian cancer 1.200 3.3e-04
spina bifida -2.037 3.2e-02

Synonym

Accession Q8N6N6 A8MWQ7 B3KX70
Symbols Gtlf3b
C17orf103

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 Compartment GO Term (0)

AA Sequence

MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYRGRGIA      1 - 70
KHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP                                71 - 113
//

Text Mined References (5)

PMID Year Title