Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.72
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.200 0.000

Gene RIF (1)

PMID Text
25380116 a newly identified acrosomal protein, IQCF1, is closely related to sperm capacitation and AR; in particular, it is involved in tyrosine phosphorylation of sperm proteins through interaction with CaM

AA Sequence

MEEKQPQKTKEPSKEDEPQQKEMPTHLSLGAESKAEAKTPVLVETQTVDNANEKSEKPPENQKKLSDKDT      1 - 70
VATKIQAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAFSRKEWAAVTLQSQARMWRI     71 - 140
RRRYCQVLNAVRIIQAYWRCRSCASRGFIKGQYRVTANQLHLQLEILLDSGPCIVTECIPFSIKE         141 - 205
//

Text Mined References (5)

PMID Year Title
25380116 2015 A novel acrosomal protein, IQCF1, involved in sperm capacitation and the acrosome reaction.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.