Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $452,466
PubMed Score 57.78
PubTator Score 85.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 0.002
acute quadriplegic myopathy -1.152 0.000
adrenocortical carcinoma -1.168 0.000
group 4 medulloblastoma -1.100 0.023
spina bifida -2.077 0.001
Breast cancer -1.100 0.000
ulcerative colitis 1.100 0.000
ovarian cancer 1.900 0.001
pituitary cancer -1.300 0.000

Synonym

Accession Q8N6M6 Q5T9B1 Q5T9B3 Q5T9B4 Q8WUL6 Q96M23 Q96SS1 AP-O
Symbols APO
AP-O
AOPEP
ONPEP
C90RF3

Gene

PANTHER Protein Class (3)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15687497 Data suggest that aminopeptidase O could play a role in the proteolytic processing of bioactive peptides in those tissues where it is expressed.

AA Sequence

MDIQLDPARDDLPLMANTSHILVKHYVLDLDVDFESQVIEGTIVLFLEDGNRFKKQNSSIEEACQSESNK      1 - 70
ACKFGMPEPCHIPVTNARTFSSEMEYNDFAICSKGEKDTSDKDGNHDNQEHASGISSSKYCCDTGNHGSE     71 - 140
DFLLVLDCCDLSVLKVEEVDVAAVPGLEKFTRSPELTVVSEEFRNQIVRELVTLPANRWREQLDYYARCS    141 - 210
QAPGCGELLFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRA    211 - 280
LFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPTQLWEECSSWYYYVTMPMPASTFTIAVGCWTEMK    281 - 350
METWSSNDLATERPFSPSEANFRHVGVCSHMEYPCRFQNASATTQEIIPHRVFAPVCLTGACQETLLRLI    351 - 420
PPCLSAAHSVLGAHPFSRLDVLIVPANFPSLGMASPHIMFLSQSILTGGNHLCGTRLCHEIAHAWFGLAI    421 - 490
GARDWTEEWLSEGFATHLEDVFWATAQQLAPYEAREQQELRACLRWRRLQDEMQCSPEEMQVLRPSKDKT    491 - 560
GHTSDSGASVIKHGLNPEKIFMQVHYLKGYFLLRFLAKRLGDETYFSFLRKFVHTFHGQLILSQDFLQML    561 - 630
LENIPEEKRLELSVENIYQDWLESSGIPKPLQRERRAGAECGLARQVRAEVTKWIGVNRRPRKRKRREKE    631 - 700
EVFEKLLPDQLVLLLEHLLEQKTLSPRTLQSLQRTYHLQDQDAEVRHRWCELIVKHKFTKAYKSVERFLQ    701 - 770
EDQAMGVYLYGELMVSEDARQQQLARRCFERTKEQMDRSSAQVVAEMLF                         771 - 819
//

Text Mined References (12)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
22544366 2012 Meta-analysis identifies six new susceptibility loci for atrial fibrillation.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15687497 2005 Identification of human aminopeptidase O, a novel metalloprotease with structural similarity to aminopeptidase B and leukotriene A4 hydrolase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...