Property Summary

NCBI Gene PubMed Count 7
Grant Count 4
R01 Count 2
Funding $266,239
PubMed Score 25.35
PubTator Score 19.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N6M3 A1L492 B9EGQ4 Q5TE59 Q9H3Y1
Symbols Fit2
C20orf142
dJ881L22.2

Gene

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNVYFVKVAWAWTFC      1 - 70
LLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGSCYQSPALEGVRKEHQSKQQC     71 - 140
HQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDRSHCLHTAITTLVVALGILTFIWVLMFLCTA    141 - 210
VYFHNLSQKVFGTLFGLLSWYGTYGFWYPKAFSPGLPPQSCSLNLKQDSYKK                      211 - 262
//

Text Mined References (7)

PMID Year Title
22158537 2011 Meta-analysis of genome-wide association studies identifies eight new loci for type 2 diabetes in east Asians.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18160536 2008 Evolutionarily conserved gene family important for fat storage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.