Property Summary

NCBI Gene PubMed Count 8
PubMed Score 17.25
PubTator Score 19.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q8N6M3 A1L492 B9EGQ4 Q5TE59 Q9H3Y1
Symbols Fit2
C20orf142
dJ881L22.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNVYFVKVAWAWTFC      1 - 70
LLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGSCYQSPALEGVRKEHQSKQQC     71 - 140
HQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDRSHCLHTAITTLVVALGILTFIWVLMFLCTA    141 - 210
VYFHNLSQKVFGTLFGLLSWYGTYGFWYPKAFSPGLPPQSCSLNLKQDSYKK                      211 - 262
//

Text Mined References (8)

PMID Year Title