Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.24
PubTator Score 0.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
acute myeloid leukemia 780
osteosarcoma 7,933

AA Sequence

MQSSALVESLITVKMAAENSEEGNTCIIPQRNLFKALSEEAWNSGFMGNSSRTADKENTLQCPKTPLRQD      1 - 70
LEANEQDARPKQENHLHSLGRNKVGYHLHPSDKGQFDHSKDGWLGPGPMPAVHKAANGHSRTKMISTSIK     71 - 140
TARKSKRASGLRINDYDNQCDVVYISQPITECHFENQKSILSSRKTARKSTRGYFFNGDCCELPTVRTLA    141 - 210
RNLHSQEKASCSALASEAVFTPKQTLTIPAPRHTVDVQLPREDNPEEPSKEITSHEEGGGDVSPRKEPQE    211 - 280
PEVCPTKIKPNLSSSPRSEETTASSLVWPLPAHLPEEDLPEGGSTVSAPTASGMSSPEHNQPPVALLDTE    281 - 350
EMSVPQDCHLLPSTESFSGGVSEDVISRPHSPPEIVSREESPQCSENQSSPMGLEPPMSLGKAEDNQSIS    351 - 420
AEVESGDTQELNVDPLLKESSTFTDENPSETEESEAAGGIGKLEGEDGDVKCLSEKDTYDTSIDSLEENL    421 - 490
DKKKKGKKFPEASDRCLRSQLSDSSSADRCLRNQSSDSSSACLEIKVPKNPSAKRSKKEGHPGGTTPKGL    491 - 560
LPDSFHTETLEDTEKPSVNERPSEKDAEQEGEGGGIITRQTLKNMLDKEVKELRGEIFPSRDPITTAGQP    561 - 630
LPGERLEIYVQSKMDEKNAHIPSESIACKRDPEQAKEEPGHIPTQHVEEAVNEVDNENTQQKDDESDAPC    631 - 700
SSLGLSSSGSGDAARAPKSVPRPKRLTSSTYNLRHAHSLGSLDASKVTSEKEAAQVNPIMPKENGASESG    701 - 770
DPLDEDDVDTVVDEQPKFMEWCAEEENQELIANFNAQYMKVQKGWIQLEKEGQPTPRARNKSDKLKEIWK    771 - 840
SKKRSRKCRSSLESQKCSPVQMLFMTNFKLSNVCKWFLETTETRSLVIVKKLNTRLPGDVPPVKHPLQKY    841 - 910
APSSLYPSSLQAERLKKHLKKFPGATPAKNNWKMQKLWAKFRENPDQVEPEDGSDVSPGPNSEDSIEEVK    911 - 980
EDRNSHPPANLPTPASTRILRKYSNIRGKLRAQQRLIKNEKMECPDALAVESKPSRKSVCINPLMSPKLA    981 - 1050
LQVDADGFPVKPKSTEGMKGRKGKQVSEILPKAEVQSKRKRTEGSSPPDSKNKGPTVKASKEKHADGATK   1051 - 1120
TPAAKRPAARDRSSQPPKKTSLKENKVKIPKKSAGKSCPPSRKEKENTNKRPSQSIASETLTKPAKQKGA   1121 - 1190
GESSSRPQKATNRKQSSGKTRARPSTKTPESSAAQRKRKLKAKLDCSHSKRRRLDAK                1191 - 1247
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24550272 2014 Reciprocal interactions of human C10orf12 and C17orf96 with PRC2 revealed by BioTAP-XL cross-linking and affinity purification.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...