Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N616
Symbols TMEM148
NCRNA00311

 Compartment GO Term (0)

AA Sequence

MVAADQGRGWNPLDGPTWEVLAMPLPLGPATQVPALFSAALVPPVSSLRPNQMLDWQRLKTPHGAPVACS      1 - 70
LGLSGEWVPTPCALSILALLGLQLDPLFGLWGCTRTLFWSEWARESRRP                          71 - 119
//

Text Mined References (3)

PMID Year Title