Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.25
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Myoclonic dystonia 5 0.0 0.0
Disease Target Count Z-score Confidence
Dystonia 164 3.383 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 6.7e-07
group 4 medulloblastoma -1.200 1.3e-04
malignant mesothelioma -1.600 4.2e-07
medulloblastoma, large-cell -1.100 7.4e-04
psoriasis -1.100 5.1e-03

Gene RIF (1)

AA Sequence

MQTPRPAMRMEAGEAAPPAGAGGRAAGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGEELQSDR      1 - 70
DETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQVPP     71 - 140
KHVYRVLQCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHSTPNGLSSESSRKT    141 - 210
KSTEEQLEEQQQQEEEVEEVEVEQVQVEADAQEKAQSSQDPANLFSLPPLPPPPLPAGGSRPHPLRPEAE    211 - 280
LAVRASPRPLARPQSCHPCCYKPEAPGCEAPDHLQGLGVPI                                 281 - 321
//

Text Mined References (14)

PMID Year Title