Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung cancer -2.528 0.000
lung adenocarcinoma -2.100 0.000
lung carcinoma -2.200 0.000
psoriasis -1.100 0.007

Gene RIF (1)

PMID Text
18976975 Knockdown of membrane-spanning 4-domains, subfamily A, member 15 (MS4A15) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDLRPVETFLTGE      1 - 70
PKVLGTVQILIGLIHLGFGSVLLMVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSL     71 - 140
GTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLP    141 - 210
NAFSADFNIPSPAASAPPAYDNVAYAQGVV                                            211 - 240
//

Text Mined References (5)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.