Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung cancer 2890 3.3e-23
lung carcinoma 2843 9.4e-12
lung adenocarcinoma 2716 2.4e-09
psoriasis 6694 6.8e-03

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.800 2.4e-09
lung carcinoma -2.200 9.4e-12
non-small cell lung cancer -2.528 3.3e-23
psoriasis -1.100 6.8e-03

Gene RIF (1)

AA Sequence

MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDLRPVETFLTGE      1 - 70
PKVLGTVQILIGLIHLGFGSVLLMVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSL     71 - 140
GTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLP    141 - 210
NAFSADFNIPSPAASAPPAYDNVAYAQGVV                                            211 - 240
//

Text Mined References (5)

PMID Year Title