Property Summary

NCBI Gene PubMed Count 4
Grant Count 2
Funding $102,577
PubMed Score 0.38
PubTator Score 0.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.300 0.000
glioblastoma -1.800 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.400 0.002
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.300 0.000

Gene RIF (1)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.

AA Sequence

MGAQPGEPQNTCSRIQTLFRRVKTLLIKAPPPPQPPPPPPSWNPGCTHVYGYAFGHMHDNNLEHLPSQQV      1 - 70
LDTGEQLMVPVEVLEVDNKEALWKFLLSGAMAGAVSRTGTAPLDRAKVYMQVYSSKTNFTNLLGGLQSMV     71 - 140
QEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGIQGSPPFQERLLAGSLAVAISQTLINPMEVL    141 - 210
KTRLTLRRTGQYKGLLDCARQILQREGTRALYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDP    211 - 280
SGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKV    281 - 350
LPAGGISYVVYEAMKKTLGI                                                      351 - 370
//

Text Mined References (6)

PMID Year Title
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
16949250 2006 Fourteen novel human members of mitochondrial solute carrier family 25 (SLC25) widely expressed in the central nervous system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.