Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.19
PubTator Score 3.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Endocarditis 19 3.061 1.5

Expression

Gene RIF (2)

AA Sequence

MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAG      1 - 70
AANAGPAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQDYKHLCQDLSFCQDLSSSLHS     71 - 140
DSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISL                         141 - 189
//

Text Mined References (13)

PMID Year Title