Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.11
PubTator Score 0.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.432 1.0e-05
atypical teratoid / rhabdoid tumor -1.200 7.6e-04
glioblastoma -1.300 7.3e-03
group 3 medulloblastoma 1.600 2.8e-02
invasive ductal carcinoma 1.100 7.3e-04
osteosarcoma -1.572 7.2e-04
tuberculosis -1.600 2.8e-07

 GO Process (1)

Gene RIF (4)

AA Sequence

MKRRNADCSKLRRPLKRNRITEGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFR      1 - 70
YQGLAFSVFFVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRF     71 - 140
KDLKNFHVDLCRPFAAHCIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQQMLQK    141 - 210
QEKEAEEAAKGLPDMDSSILIHHNGGIPANKKLSTTLPEIEYREKGKEKDKDAKKHNLGINNNNILQPVD    211 - 280
SKIQEIEYMENHINSKRLNNDLVGSTENLLKEDSCTASSKNYKNASGVVNSSPRSHSATNGSIPSSSSKN    281 - 350
EKKQKCTSKSPSTHKDLMENCIPNNQLSKPDALVRLEQDIKKLKADLQASRQVEQELRSQISSLSSTERG    351 - 420
IRSEMGQLRQENELLQNKLHNAVQMKQKDKQNISQLEKKLKAEQEARSFVEKQLMEEKKRKKLEEATAAR    421 - 490
AVAFAAASRGECTETLRNRIRELEAEGKKLTMDMKVKEDQIRELELKVQELRKYKENEKDTEVLMSALSA    491 - 560
MQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKDQEIKDLKQKIAEVMAVMPSITYSAAT    561 - 630
SPLSPVSPHYSSKFVETSPSGLDPNASVYQPLKK                                        631 - 664
//

Text Mined References (22)

PMID Year Title