Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.61
PubTator Score 0.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.572 0.001
group 3 medulloblastoma 1.600 0.028
atypical teratoid / rhabdoid tumor -1.400 0.007
glioblastoma -1.300 0.007
acute quadriplegic myopathy 1.432 0.000
tuberculosis -1.600 0.000
invasive ductal carcinoma 1.100 0.001

Synonym

Accession Q8N5G2 B1AK00 Q2TLX5 Q2TLX6 Q9NVG6
Symbols MACOILIN

Gene

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19060911 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MKRRNADCSKLRRPLKRNRITEGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFR      1 - 70
YQGLAFSVFFVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRF     71 - 140
KDLKNFHVDLCRPFAAHCIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQQMLQK    141 - 210
QEKEAEEAAKGLPDMDSSILIHHNGGIPANKKLSTTLPEIEYREKGKEKDKDAKKHNLGINNNNILQPVD    211 - 280
SKIQEIEYMENHINSKRLNNDLVGSTENLLKEDSCTASSKNYKNASGVVNSSPRSHSATNGSIPSSSSKN    281 - 350
EKKQKCTSKSPSTHKDLMENCIPNNQLSKPDALVRLEQDIKKLKADLQASRQVEQELRSQISSLSSTERG    351 - 420
IRSEMGQLRQENELLQNKLHNAVQMKQKDKQNISQLEKKLKAEQEARSFVEKQLMEEKKRKKLEEATAAR    421 - 490
AVAFAAASRGECTETLRNRIRELEAEGKKLTMDMKVKEDQIRELELKVQELRKYKENEKDTEVLMSALSA    491 - 560
MQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKDQEIKDLKQKIAEVMAVMPSITYSAAT    561 - 630
SPLSPVSPHYSSKFVETSPSGLDPNASVYQPLKK                                        631 - 664
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21700265 2011 Complement receptor 1 gene variants are associated with erythrocyte sedimentation rate.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...