Property Summary

NCBI Gene PubMed Count 15
PubMed Score 236.38
PubTator Score 7.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis 1563 1.15454889282999E-5
gastric carcinoma 832 0.0422299551810654
Disease Target Count Z-score Confidence
Galactosemia 20 3.999 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis 1.400 0.000
gastric carcinoma -1.400 0.042

Synonym

Accession Q8N5D6 A8K633 B2RA95 B7Z8S5 Q45F07 Q5T7U9 Q5T7V1 Q8N2K4 Q9UKI5
Symbols FS
A3GALNT
UNQ2513

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25294702 GBGT1 expression is epigenetically silenced through promoter hypermethylation in ovarian cancer.
23255552 The Fs synthase gene, GBGT1, in A(pae) individuals encoded an arginine to glutamine change at residue 296.
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MHRRRLALGLGFCLLAGTSLSVLWVYLENWLPVSYVPYYLPCPEIFNMKLHYKREKPLQPVVWSQYPQPK      1 - 70
LLEHRPTQLLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGVTVFAVGKYTHFIQSFLESAEEFFMRGY     71 - 140
RVHYYIFTDNPAAVPGVPLGPHRLLSSIPIQGHSHWEETSMRRMETISQHIAKRAHREVDYLFCLDVDMV    141 - 210
FRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCH    211 - 280
MAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS       281 - 347
//

Text Mined References (15)

PMID Year Title
25294702 2014 Expression of GBGT1 is epigenetically regulated by DNA methylation in ovarian cancer cells.
23255552 2013 Forssman expression on human erythrocytes: biochemical and genetic evidence of a new histo-blood group system.
23240079 2012 Molecular genetic basis of the human Forssman glycolipid antigen negativity.
22419656 2012 Mucosal genome-wide methylation changes in inflammatory bowel disease.
21627641 2011 Exome sequencing in a family segregating for celiac disease.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19218399 2009 Human pseudogenes of the ABO family show a complex evolutionary dynamics and loss of function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...