Property Summary

NCBI Gene PubMed Count 15
PubMed Score 247.04
PubTator Score 7.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 1.2e-05
gastric carcinoma 807 4.2e-02
Disease Target Count Z-score Confidence
Galactosemia 19 4.019 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
gastric carcinoma -1.400 4.2e-02
tuberculosis 1.400 1.2e-05

Gene RIF (3)

AA Sequence

MHRRRLALGLGFCLLAGTSLSVLWVYLENWLPVSYVPYYLPCPEIFNMKLHYKREKPLQPVVWSQYPQPK      1 - 70
LLEHRPTQLLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGVTVFAVGKYTHFIQSFLESAEEFFMRGY     71 - 140
RVHYYIFTDNPAAVPGVPLGPHRLLSSIPIQGHSHWEETSMRRMETISQHIAKRAHREVDYLFCLDVDMV    141 - 210
FRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCH    211 - 280
MAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS       281 - 347
//

Text Mined References (15)

PMID Year Title