Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 2.6e-09
atypical teratoid / rhabdoid tumor 2.200 4.1e-09
ependymoma 1.200 4.3e-10
glioblastoma 1.300 1.0e-08
group 3 medulloblastoma 1.100 3.1e-04
inflammatory breast cancer -1.300 7.9e-09
medulloblastoma, large-cell 1.300 1.0e-04
ovarian cancer -1.100 3.0e-05
pediatric high grade glioma 1.200 4.9e-08
primitive neuroectodermal tumor 1.700 4.4e-06
subependymal giant cell astrocytoma 1.031 4.4e-02

AA Sequence

MAAIYLSRGFFSREPICPFEEKTKVERMVEDYLASGYQDSVTFDDVAVDFTPEEWALLDTTEKYLYRDVM      1 - 70
LENYMNLASVEWEIQPRTKRSSLQQGFLKNQIFSGIQMTRGYSGWKLCDCKNCGEVFREQFCLKTHMRVQ     71 - 140
NGGNTSEGNCYGKDTLSVHKEASTGQELSKFNPCGKVFTLTPGLAVHLEVLNARQPYKCKECGKGFKYFA    141 - 210
SLDNHMGIHTDEKLCEFQEYGRAVTASSHLKQCVAVHTGKKSKKTKKCGKSFTNFSQLYAPVKTHKGEKS    211 - 280
FECKECGRSFRNSSCLNDHIQIHTGIKPHKCTYCGKAFTRSTQLTEHVRTHTGIKPYECKECGQAFAQYS    281 - 350
GLSIHIRSHSGKKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYECVECGKTFITSSRRSKHLKTHSGEKP    351 - 420
FVCKICGKAFLYSSRLNVHLRTHTGEKPFVCKECGKAFAVSSRLSRHERIHTGEKPYECKDMSVTI        421 - 486
//

Text Mined References (6)

PMID Year Title