Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.300 3.5e-03
atypical teratoid / rhabdoid tumor 1.600 1.3e-04
Breast cancer -1.200 1.1e-11
diabetes mellitus -1.100 1.6e-02
ependymoma 2.100 4.7e-02
glioblastoma 1.600 1.7e-05
hepatocellular carcinoma -1.400 1.1e-04
lung adenocarcinoma -1.100 3.6e-09
medulloblastoma 1.100 4.1e-03
medulloblastoma, large-cell -1.400 1.2e-03
mucosa-associated lymphoid tissue lympho... 1.257 4.4e-02
non-small cell lung carcinoma -1.100 1.8e-16
osteosarcoma -2.534 1.0e-05
ovarian cancer -2.000 2.1e-13
pancreatic cancer -1.100 4.3e-03
pancreatic carcinoma -1.100 4.3e-03
spina bifida -1.453 3.6e-02
tuberculosis and treatment for 6 months 1.100 1.0e-02

Synonym

Accession Q8N4U5 B2RA65 G3V1Y9
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPFNGEKQCVGEDQPSDSDSSRFSESMASLSDYECSRQSFASDSSSKSSSPASTSPPRVVTFDEVMATAR      1 - 70
NLSNLTLAHEIAVNENFQLKQEALPEKSLAGRVKHIVHQAFWDVLDSELNADPPEFEHAIKLFEEIREIL     71 - 140
LSFLTPGGNRLRNQICEVLDTDLIRQQAEHSAVDIQGLANYVISTMGKLCAPVRDNDIRELKATGNIVEV    141 - 210
LRQIFHVLDLMQMDMANFTIMSLRPHLQRQLVEYERTKFQEILEETPSALDQTTEWIKESVNEELFSLSE    211 - 280
SALTPGAENTSKPSLSPTLVLNNSYLKLLQWDYQKKELPETLMTDGARLQELTEKLNQLKIIACLSLITN    281 - 350
NMVGAITGGLPELASRLTRISAVLLEGMNKETFNLKEVLNSIGIQTCVEVNKTLMERGLPTLNAEIQANL    351 - 420
IGQFSSIEEEDNPIWSLIDKRIKLYMRRLLCLPSPQKCMPPMPGGLAVIQQELEALGSQYANIVNLNKQV    421 - 490
YGPFYANILRKLLFNEEAMGKVDASPPTN                                             491 - 519
//

Text Mined References (5)

PMID Year Title