Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
hepatocellular carcinoma -1.400 0.000
pancreatic cancer -1.100 0.004
ependymoma 2.100 0.047
osteosarcoma -2.534 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.600 0.000
medulloblastoma 1.100 0.004
medulloblastoma, large-cell 1.900 0.000
tuberculosis and treatment for 6 months 1.100 0.010
diabetes mellitus -1.100 0.016
lung adenocarcinoma -1.300 0.000
adult high grade glioma 1.300 0.004
pancreatic carcinoma -1.100 0.004
non-small cell lung carcinoma -1.100 0.000
spina bifida -1.453 0.036
Breast cancer -1.200 0.000
mucosa-associated lymphoid tissue lympho... 1.257 0.044
ovarian cancer 2.900 0.000

AA Sequence

MPFNGEKQCVGEDQPSDSDSSRFSESMASLSDYECSRQSFASDSSSKSSSPASTSPPRVVTFDEVMATAR      1 - 70
NLSNLTLAHEIAVNENFQLKQEALPEKSLAGRVKHIVHQAFWDVLDSELNADPPEFEHAIKLFEEIREIL     71 - 140
LSFLTPGGNRLRNQICEVLDTDLIRQQAEHSAVDIQGLANYVISTMGKLCAPVRDNDIRELKATGNIVEV    141 - 210
LRQIFHVLDLMQMDMANFTIMSLRPHLQRQLVEYERTKFQEILEETPSALDQTTEWIKESVNEELFSLSE    211 - 280
SALTPGAENTSKPSLSPTLVLNNSYLKLLQWDYQKKELPETLMTDGARLQELTEKLNQLKIIACLSLITN    281 - 350
NMVGAITGGLPELASRLTRISAVLLEGMNKETFNLKEVLNSIGIQTCVEVNKTLMERGLPTLNAEIQANL    351 - 420
IGQFSSIEEEDNPIWSLIDKRIKLYMRRLLCLPSPQKCMPPMPGGLAVIQQELEALGSQYANIVNLNKQV    421 - 490
YGPFYANILRKLLFNEEAMGKVDASPPTN                                             491 - 519
//

Text Mined References (5)

PMID Year Title
22889924 2013 Genome-wide association study of Tourette's syndrome.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.