Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.79530634286552E-16
lung adenocarcinoma 2714 5.6290163551053E-16
ovarian cancer 8492 6.83447700276546E-13
Breast cancer 3099 1.06695103654993E-11
medulloblastoma, large-cell 6234 4.92238706807598E-6
osteosarcoma 7933 1.03523064966551E-5
glioblastoma 5572 1.70625811792307E-5
hepatocellular carcinoma 550 1.1050786590268E-4
atypical teratoid / rhabdoid tumor 4369 1.33037608430659E-4
adult high grade glioma 2148 0.00354194279870119
medulloblastoma 1524 0.00413446880605121
pancreatic carcinoma 567 0.00429831116919076
pancreatic cancer 2300 0.00429831116919078
tuberculosis and treatment for 6 months 686 0.0100748178243773
diabetes mellitus 1663 0.0155433625469169
spina bifida 1064 0.035817889435841
mucosa-associated lymphoid tissue lymphoma 480 0.0440262234837363
ependymoma 2514 0.0469633653849602

Expression

  Differential Expression (18)

Disease log2 FC p
hepatocellular carcinoma -1.400 0.000
pancreatic cancer -1.100 0.004
ependymoma 2.100 0.047
osteosarcoma -2.534 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.600 0.000
medulloblastoma 1.100 0.004
medulloblastoma, large-cell 1.900 0.000
tuberculosis and treatment for 6 months 1.100 0.010
diabetes mellitus -1.100 0.016
lung adenocarcinoma -1.300 0.000
adult high grade glioma 1.300 0.004
pancreatic carcinoma -1.100 0.004
non-small cell lung carcinoma -1.100 0.000
spina bifida -1.453 0.036
Breast cancer -1.200 0.000
mucosa-associated lymphoid tissue lympho... 1.257 0.044
ovarian cancer 2.900 0.000

Synonym

Accession Q8N4U5 B2RA65 G3V1Y9
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (11)

AA Sequence

MPFNGEKQCVGEDQPSDSDSSRFSESMASLSDYECSRQSFASDSSSKSSSPASTSPPRVVTFDEVMATAR      1 - 70
NLSNLTLAHEIAVNENFQLKQEALPEKSLAGRVKHIVHQAFWDVLDSELNADPPEFEHAIKLFEEIREIL     71 - 140
LSFLTPGGNRLRNQICEVLDTDLIRQQAEHSAVDIQGLANYVISTMGKLCAPVRDNDIRELKATGNIVEV    141 - 210
LRQIFHVLDLMQMDMANFTIMSLRPHLQRQLVEYERTKFQEILEETPSALDQTTEWIKESVNEELFSLSE    211 - 280
SALTPGAENTSKPSLSPTLVLNNSYLKLLQWDYQKKELPETLMTDGARLQELTEKLNQLKIIACLSLITN    281 - 350
NMVGAITGGLPELASRLTRISAVLLEGMNKETFNLKEVLNSIGIQTCVEVNKTLMERGLPTLNAEIQANL    351 - 420
IGQFSSIEEEDNPIWSLIDKRIKLYMRRLLCLPSPQKCMPPMPGGLAVIQQELEALGSQYANIVNLNKQV    421 - 490
YGPFYANILRKLLFNEEAMGKVDASPPTN                                             491 - 519
//

Text Mined References (5)

PMID Year Title
22889924 2013 Genome-wide association study of Tourette's syndrome.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.