Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.09
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Protein-protein Interaction (7)

Gene RIF (1)

AA Sequence

MELSCPGSRCPVQEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILKAKGTLRPPERQALFGSW      1 - 70
ELIYGASQELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQLKKNKGFRRFVRLQEGRPEF     71 - 140
GGLQLQDLLPLPLQRLQQYENLVVALAENTGPNSPDHQQLTRAARLISETAQRVHTIGQKQKNDQHLRRV    141 - 210
QALLSGRQAKGLTSGRWFLRQGWLLVVPPHGEPRPRMFFLFTDVLLMAKPRPPLHLLRSGTFACKALYPM    211 - 280
AQCHLSRVFGHSGGPCGGLLSLSFPHEKLLLMSTDQEELSRWYHSLTWAISSQKN                   281 - 335
//

Text Mined References (8)

PMID Year Title