Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 1.500 6.9e-13
colon cancer 1.100 2.8e-05
invasive ductal carcinoma 1.200 7.6e-03
malignant mesothelioma 1.600 3.6e-07
osteosarcoma -1.854 2.2e-06
ovarian cancer 1.100 4.6e-06
subependymal giant cell astrocytoma -1.168 2.5e-02

AA Sequence

MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALLGFLVLVPMTM      1 - 70
PWGQLGKDGWLGGTHCVACLAPPAGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHCTLA     71 - 140
CRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMD    141 - 210
ALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD           211 - 273
//

Text Mined References (7)

PMID Year Title