Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.05
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 2.4
Disease Target Count Z-score Confidence
Ataxia telangiectasia 34 3.313 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.600 1.0e-09
group 3 medulloblastoma 1.700 1.6e-03
invasive ductal carcinoma -1.100 5.6e-04
osteosarcoma 1.214 7.1e-03
posterior fossa group B ependymoma 1.100 6.5e-05
progressive supranuclear palsy -1.200 8.1e-03

AA Sequence

MIHVRRHETRRNSKSHVPEQKSRVDWRRTKRSSISQLLDSDEELDSEEFDSDEELDSDESFENDEELDSN      1 - 70
KGPDCNKTPGSERELNLSKIQSEGNDSKCLINSGNGSTYEEETNKIKHRNIDLQDQEKHLSQEDNDLNKQ     71 - 140
TGQIIEDDQEKHLSQEDNDLNKQTGQIIEDDLEEEDIKRGKRKRLSSVMCDSDESDDSDILVRKVGVKRP    141 - 210
RRVVEDEGSSVEMEQKTPEKTLAAQKREKLQKLKELSKQRSRQRRSSGRDFEDSEKESCPSSDEVDEEEE    211 - 280
EDNYESDEDGDDYIIDDFVVQDEEGDEENKNQQGEKLTTSQLKLVKQNSLYSFSDHYTHFERVVKALLIN    281 - 350
ALDESFLGTLYDGTRQKSYAKDMLTSLHYLDNRFVQPRLESLVSRSRWKEQYKERVENYSNVSIHLKNPE    351 - 420
NCSCQACGLHRYCKYSVHLSGELYNTRTMQIDNFMSHDKQVFTVGRICASRTRIYHKLKHFKFKLYQECC    421 - 490
TIAMTEEVEDEQVKETVERIFRRSKENGWIKEKYGQLEEYLNFADYFQEEKFEL                    491 - 544
//

Text Mined References (16)

PMID Year Title