Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.92
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Inguinal hernia 13 3.729 1.9

Expression

Synonym

Accession Q8N4P3
Symbols MESH1
(ppGpp)ase

Gene

PANTHER Protein Class (2)

PDB

3NR1  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG
Fruitfly OMA EggNOG

Gene RIF (1)

PMID Text
20818390 Mesh1, encoded by HDDC3 in humans, contains an active site for ppGpp hydrolysis and a conserved His-Asp-box motif for Mn(2+) binding. It catalyzes hydrolysis of ppGpp both in vitro and in vivo.

AA Sequence

MGSEAAQLLEAADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALLHDTVEDTDTT      1 - 70
LDEVELHFGAQVRRLVEEVTDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEGWSE     71 - 140
HRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQRGLTI                                   141 - 179
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
20818390 2010 A metazoan ortholog of SpoT hydrolyzes ppGpp and functions in starvation responses.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...