Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $969,356
PubMed Score 8.92
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Inguinal hernia 13 3.729 1.9

Expression

Gene RIF (1)

PMID Text
20818390 Mesh1, encoded by HDDC3 in humans, contains an active site for ppGpp hydrolysis and a conserved His-Asp-box motif for Mn(2+) binding. It catalyzes hydrolysis of ppGpp both in vitro and in vivo.

AA Sequence

MGSEAAQLLEAADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALLHDTVEDTDTT      1 - 70
LDEVELHFGAQVRRLVEEVTDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEGWSE     71 - 140
HRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQRGLTI                                   141 - 179
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
20818390 2010 A metazoan ortholog of SpoT hydrolyzes ppGpp and functions in starvation responses.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...