Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.84
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Inguinal hernia 14 3.761 1.9

Expression

Synonym

Accession Q8N4P3
Symbols MESH1
(ppGpp)ase

Gene

PDB

3NR1  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGSEAAQLLEAADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALLHDTVEDTDTT      1 - 70
LDEVELHFGAQVRRLVEEVTDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEGWSE     71 - 140
HRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQRGLTI                                   141 - 179
//

Text Mined References (12)

PMID Year Title