Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.01
PubTator Score 5.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.97884916100081E-16
interstitial cystitis 2299 7.87689817991711E-6
pituitary cancer 1972 8.21012364758992E-6
ovarian cancer 8492 3.86885219986637E-5
cystic fibrosis 1670 1.03723311339677E-4
pilocytic astrocytoma 3086 2.48297349297644E-4
posterior fossa group A ependymoma 1511 7.89672659991484E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.38778415053532E-4
group 3 medulloblastoma 2254 0.00184480152516714
aldosterone-producing adenoma 664 0.00687670194406204
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0122986534393199
ductal carcinoma in situ 1745 0.0263224400852642
medulloblastoma, large-cell 6234 0.0313653459658695

Expression

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MHCLGAEYLVSAEGAPRQREWRPQIYRKCTDTAWLFLFFLFWTGLVFIMGYSVVAGAAGRLLFGYDSFGN      1 - 70
MCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEVKGTQLNRMALCVSNCPEEQLDSLEEVQFFANTSGS     71 - 140
FLCVYSLNSFNYTHSPKADSLCPRLPVPPSKSFPLFNRCVPQTPECYSLFASVLINDVDTLHRILSGIMS    141 - 210
GRDTILGLCILALALSLAMMFTFRFITTLLVHIFISLVILGLLFVCGVLWWLYYDYTNDLSIELDTEREN    211 - 280
MKCVLGFAIVSTGITAVLLVLIFVLRKRIKLTVELFQITNKAISSAPFLLFQPLWTFAILIFFWVLWVAV    281 - 350
LLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLIGLIWTSEFILACQQMTIAGAVVTCYFNRSKNDPPD    351 - 420
HPILSSLSILFFYHQGTVVKGSFLISVVRIPRIIVMYMQNALKEQQHGALSRYLFRCCYCCFWCLDKYLL    421 - 490
HLNQNAYTTTAINGTDFCTSAKDAFKILSKNSSHFTSINCFGDFIIFLGKVLVVCFTVFGGLMAFNYNRA    491 - 560
FQVWAVPLLLVAFFAYLVAHSFLSVFETVLDALFLCFAVDLETNDGSSEKPYFMDQEFLSFVKRSNKLNN    561 - 630
ARAQQDKHSLRNEEGTELQAIVR                                                   631 - 653
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
22238593 2012 A genome-wide association search for type 2 diabetes genes in African Americans.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15715662 2005 Molecular characterization of the family of choline transporter-like proteins and their splice variants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...