Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.19322681692653E-19
atypical teratoid / rhabdoid tumor 4369 5.76004226604009E-8
glioblastoma 5572 4.30997710295584E-6
pilocytic astrocytoma 3086 5.54325078897246E-6
primitive neuroectodermal tumor 3031 2.88984478878622E-5
pediatric high grade glioma 2712 1.48406357524031E-4
astrocytic glioma 2241 0.00614209586623062
ependymoma 2514 0.0140764796094425
oligodendroglioma 2849 0.0168101452691305
medulloblastoma 1524 0.0188462070344828
medulloblastoma, large-cell 6234 0.0195417606629877
Breast cancer 3099 0.028790820293227

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.400 0.006
ependymoma -2.400 0.014
oligodendroglioma -2.000 0.017
glioblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma -1.700 0.019
medulloblastoma, large-cell -1.900 0.020
primitive neuroectodermal tumor -2.100 0.000
pediatric high grade glioma -1.800 0.000
pilocytic astrocytoma -2.000 0.000
Breast cancer 1.500 0.029
psoriasis -2.000 0.000

AA Sequence

MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDERSLWVSRVAQI      1 - 70
AVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY                         71 - 120
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.