Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.600 1.1e-02
astrocytic glioma -2.400 6.1e-03
Astrocytoma, Pilocytic -2.000 1.1e-05
atypical teratoid / rhabdoid tumor -2.500 5.8e-08
Breast cancer 1.500 2.9e-02
ependymoma -2.400 1.4e-02
glioblastoma -1.300 1.2e-03
medulloblastoma -1.700 1.9e-02
medulloblastoma, large-cell -1.900 2.0e-02
oligodendroglioma -2.000 1.7e-02
primitive neuroectodermal tumor -2.100 2.9e-05
psoriasis -2.000 2.2e-19

AA Sequence

MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDERSLWVSRVAQI      1 - 70
AVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY                         71 - 120
//

Text Mined References (2)

PMID Year Title