Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.400 0.006
ependymoma -2.400 0.014
oligodendroglioma -2.000 0.017
glioblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma -1.700 0.019
medulloblastoma, large-cell -1.900 0.020
primitive neuroectodermal tumor -2.100 0.000
pediatric high grade glioma -1.800 0.000
pilocytic astrocytoma -2.000 0.000
Breast cancer 1.500 0.029
psoriasis -2.000 0.000

AA Sequence

MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDERSLWVSRVAQI      1 - 70
AVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY                         71 - 120
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.